PPIST02528
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | APQLIMLANVALTGE |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2CZY |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The Neural Repressor NRSF/REST Binds the PAH1 Domain of the Sin3 Corepressor by Using its Distinct Short Hydrophobic Helix |
|---|---|
| Release_Year | 2005 |
| PMID | 16288918 |
| DOI | 10.1016/j.jmb.2005.10.008 |