PPIST02592
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | TQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | NWKLLAKGLLIRERLKR |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2A4J |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Flexibility and plasticity of human centrin 2 binding to the xeroderma pigmentosum group C protein (XPC) from nuclear excision repair. |
|---|---|
| Release_Year | 2006 |
| PMID | 16533048 |
| DOI | 10.1021/bi0524868 |