PPIST02631
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | LKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSN |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | STASTVEYSTVVHSG |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2BBU |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The Structure of SOCS3 Reveals the Basis of the Extended SH2 Domain Function and Identifies an Unstructured Insertion That Regulates Stability |
|---|---|
| Release_Year | 2006 |
| PMID | 16630890 |
| DOI | 10.1016/j.molcel.2006.03.024 |