PPIST02766
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | XNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XADYEPPX |
| Peptide_Length | 8 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2ETZ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Molecular Details of Itk Activation by Prolyl Isomerization and Phospholigand Binding: The NMR Structure of the Itk SH2 Domain Bound to a Phosphopeptide. |
|---|---|
| Release_Year | 2006 |
| PMID | 16436281 |
| DOI | 10.1016/j.jmb.2005.12.073 |