PPIST02791
Protein Information
| Protein_Chain | B[auth A] |
|---|---|
| Protein_Sequence | GSPGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEENSS |
Peptide Information
| Peptide_Chain | A[auth B] |
|---|---|
| Peptide_Sequence | XDTEVYESPYADPE |
| Peptide_Length | 14 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2FCI |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis for the requirement of two phosphotyrosine residues in signaling mediated by syk tyrosine kinase |
|---|---|
| Release_Year | 2006 |
| PMID | 16410013 |
| DOI | 10.1016/j.jmb.2005.11.095 |