PPIST02861
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | LKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | SWVYSPLH |
| Peptide_Length | 8 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2G35 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural Basis for the Phosphorylation-regulated Focal Adhesion Targeting of Type Igamma Phosphatidylinositol Phosphate Kinase (PIPKIgamma) by Talin. |
|---|---|
| Release_Year | 2006 |
| PMID | 16616931 |
| DOI | 10.1016/j.jmb.2006.02.048 |