PPIST03031
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GPLGSHMASEFINQGDVTEGNNNQEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKSKRQKRRK |
Peptide Information
| Peptide_Chain | B[auth P] |
|---|---|
| Peptide_Sequence | ARTKQTARK |
| Peptide_Length | 9 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2JMJ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs |
|---|---|
| Release_Year | 2006 |
| PMID | 17157260 |
| DOI | 10.1016/j.molcel.2006.10.026 |