PPIST03060
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XLEALFQ |
| Peptide_Length | 7 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2B0F |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR solution structures of the apo and peptide-inhibited human rhinovirus 3C protease (Serotype 14): structural and dynamic comparison |
|---|---|
| Release_Year | 2007 |
| PMID | 17944485 |
| DOI | 10.1021/bi7010866 |