PPIST03142
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GAMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | GAMGKDIQLARRIRGERA |
| Peptide_Length | 18 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2IIJ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure of the histone chaperone asf1 bound to the histone h3 C-terminal helix and functional insights. |
|---|---|
| Release_Year | 2007 |
| PMID | 17292837 |
| DOI | 10.1016/j.str.2007.01.002 |