PPIST03179
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XAPSYSPPPPP |
| Peptide_Length | 11 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2JMA |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3 |
|---|---|
| Release_Year | 2007 |
| PMID | 17407569 |
| DOI | 10.1186/1472-6807-7-22 |