PPIST03185
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GAMGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRS |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | EEPPPPYED |
| Peptide_Length | 9 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2JO9 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR Structural Studies of the ItchWW3 Domain Reveal that Phosphorylation at T30 Inhibits the Interaction with PPxY-Containing Ligands |
|---|---|
| Release_Year | 2007 |
| PMID | 17437719 |
| DOI | 10.1016/j.str.2007.03.005 |