PPIST03245
Protein Information
| Protein_Chain | B[auth A] |
|---|---|
| Protein_Sequence | ENLYFQGENLYFQGDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ |
Peptide Information
| Peptide_Chain | A[auth B] |
|---|---|
| Peptide_Sequence | GSGSTISNPPPLISSAK |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2ODD |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity. |
|---|---|
| Release_Year | 2007 |
| PMID | 17560331 |
| DOI | 10.1016/j.ccr.2007.04.010 |