PPIST03270
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | RRETQV |
| Peptide_Length | 6 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2OQS |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the hDlg/SAP97 PDZ2 domain and its mechanism of interaction with HPV-18 papillomavirus E6 protein. |
|---|---|
| Release_Year | 2007 |
| PMID | 17713926 |
| DOI | 10.1021/bi700879k |