PPIST03334
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | TVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKL |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ESVKI |
| Peptide_Length | 5 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2PKU |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Clustering and synaptic targeting of PICK1 requires direct interaction between the PDZ domain and lipid membranes |
|---|---|
| Release_Year | 2007 |
| PMID | 17914463 |
| DOI | 10.1038/sj.emboj.7601860 |