PPIST03571
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | GRSKESGWVENEIYY |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2K00 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis for the interaction between the cytoplasmic domain of the hyaluronate receptor layilin and the talin F3 subdomain |
|---|---|
| Release_Year | 2008 |
| PMID | 18638481 |
| DOI | 10.1016/j.jmb.2008.06.087 |