PPIST03579
Protein Information
| Protein_Chain | C[auth A];D[auth B] |
|---|---|
| Protein_Sequence | GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS |
Peptide Information
| Peptide_Chain | A[auth C];B[auth D] |
|---|---|
| Peptide_Sequence | KKAVWHKLLSKQ |
| Peptide_Length | 12 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2K2F |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor. |
|---|---|
| Release_Year | 2008 |
| PMID | 18650434 |
| DOI | 10.1074/jbc.M804432200 |