PPIST03585
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKP |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | EQIELPEVPSEPLPEK |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2K3W |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Two distinct modes of ESCRT-III recognition are required for VPS4 functions in lysosomal protein targeting and HIV-1 budding |
|---|---|
| Release_Year | 2008 |
| PMID | 18606141 |
| DOI | 10.1016/j.devcel.2008.05.014 |