PPIST03594
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MGSSHHHHHHSSGLVPRGSHMTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ITFLDLLLYYGKKK |
| Peptide_Length | 14 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2L6E |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of a hydrocarbon stapled peptide inhibitor in complex with monomeric C-terminal domain of HIV-1 capsid. |
|---|---|
| Release_Year | 2008 |
| PMID | 18417468 |
| DOI | 10.1074/jbc.C800048200 |