PPIST04071
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | APITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XELXX |
| Peptide_Length | 5 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2K1Q |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Binding of a noncovalent inhibitor exploiting the S' region stabilizes the hepatitis C virus NS3 protease conformation in the absence of cofactor. |
|---|---|
| Release_Year | 2009 |
| PMID | 19061898 |
| DOI | 10.1016/j.jmb.2008.11.017 |