PPIST04076
Protein Information
| Protein_Chain | B[auth A] |
|---|---|
| Protein_Sequence | DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE |
Peptide Information
| Peptide_Chain | A[auth B] |
|---|---|
| Peptide_Sequence | EDTDEDDHLIYLEEILVRV |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2K7L |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase |
|---|---|
| Release_Year | 2009 |
| PMID | 19215094 |
| DOI | 10.1021/bi801549m |