PPIST04087
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNA |
Peptide Information
| Peptide_Chain | B;C |
|---|---|
| Peptide_Sequence | QVVPFSSSV |
| Peptide_Length | 9 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KA9 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Creating conformational entropy by increasing interdomain mobility in ligand binding regulation: a revisit to N-terminal tandem PDZ domains of PSD-95 |
|---|---|
| Release_Year | 2009 |
| PMID | 19072119 |
| DOI | 10.1021/ja8076022 |