PPIST04095
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GAMAQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEE |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ARTKQTARKS |
| Peptide_Length | 10 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KE1 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The solution structure of the first PHD finger of autoimmune regulator in complex with non-modified histone H3 tail reveals the antagonistic role of H3R2 methylation |
|---|---|
| Release_Year | 2009 |
| PMID | 19293276 |
| DOI | 10.1093/nar/gkp166 |