PPIST04096
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | FNYESTNPFTAK |
| Peptide_Length | 12 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KFF |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1. |
|---|---|
| Release_Year | 2009 |
| PMID | 19798736 |
| DOI | 10.1002/pro.258 |