PPIST04104
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSRLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | DSGFSFGSK |
| Peptide_Length | 9 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KHH |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural requirements for the ubiquitin-associated domain of the mRNA export factor Mex67 to bind its specific targets, the transcription elongation THO complex component Hpr1 and nucleoporin FXFG repeats |
|---|---|
| Release_Year | 2009 |
| PMID | 19401465 |
| DOI | 10.1074/jbc.M109.004374 |