PPIST04106
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK |
Peptide Information
| Peptide_Chain | B[auth C] |
|---|---|
| Peptide_Sequence | XLPAX |
| Peptide_Length | 5 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2KID |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The structure of the Staphylococcus aureus sortase-substrate complex reveals how the universally conserved LPXTG sorting signal is recognized. |
|---|---|
| Release_Year | 2009 |
| PMID | 19592495 |
| DOI | 10.1074/jbc.M109.022624 |