PPIST04122
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | AKKTKPTPPPKPSHLKPK |
| Peptide_Length | 18 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2RPN |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p |
|---|---|
| Release_Year | 2009 |
| PMID | 19590096 |
| DOI | 10.1074/jbc.M109.028431 |