PPIST04615
Protein Information
| Protein_Chain | A[auth C] |
|---|---|
| Protein_Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS |
Peptide Information
| Peptide_Chain | B[auth I] |
|---|---|
| Peptide_Sequence | RISADAMMQALLGARAK |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KRD |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the regulatory domain of human cardiac troponin C in complex with the switch region of cardiac troponin I and W7: the basis of W7 as an inhibitor of cardiac muscle contraction. |
|---|---|
| Release_Year | 2010 |
| PMID | 20116385 |
| DOI | 10.1016/j.yjmcc.2010.01.016 |