PPIST04626
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | APRKQLATKAARKSAP |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KVM |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a. |
|---|---|
| Release_Year | 2010 |
| PMID | 20541999 |
| DOI | 10.1016/j.molcel.2010.03.021 |