PPIST04632
Protein Information
| Protein_Chain | B[auth A] |
|---|---|
| Protein_Sequence | GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS |
Peptide Information
| Peptide_Chain | A[auth B] |
|---|---|
| Peptide_Sequence | GLGKGGAKRHRKVLR |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KWN |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. |
|---|---|
| Release_Year | 2010 |
| PMID | 20613843 |
| DOI | 10.1038/nature09139 |