PPIST04656
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | CIISAMPTKSSRKAKKPAQ |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2RQU |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain. |
|---|---|
| Release_Year | 2010 |
| PMID | 20509626 |
| DOI | 10.1021/bi100563z |