PPIST05241
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GAMGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEP |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | RSSRTRRETQV |
| Peptide_Length | 11 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2KPL |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The structural and dynamic response of MAGI-1 PDZ1 with non-canonical domain boundaries to binding of human papillomavirus (HPV) E6 |
|---|---|
| Release_Year | 2011 |
| PMID | 21238461 |
| DOI | 10.1016/j.jmb.2011.01.015 |