PPIST05261
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | KENLESMV |
| Peptide_Length | 8 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2L4T |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L. |
|---|---|
| Release_Year | 2011 |
| PMID | 21417405 |
| DOI | 10.1021/bi102055y |