PPIST05263
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GPLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | KASGKGKKKRGSN |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2L5E |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis and specificity of acetylated transcription factor GATA1 recognition by BET family bromodomain protein Brd3. |
|---|---|
| Release_Year | 2011 |
| PMID | 21555453 |
| DOI | 10.1128/MCB.05413-11 |