PPIST05268
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGY |
| Peptide_Length | 14 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2L75 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9 |
|---|---|
| Release_Year | 2011 |
| PMID | 21278251 |
| DOI | 10.1074/jbc.M110.208207 |