PPIST05287
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ARTKQTARKSTG |
| Peptide_Length | 12 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2LGG |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger. |
|---|---|
| Release_Year | 2011 |
| PMID | 21808299 |
| DOI | 10.1038/cr.2011.123 |