PPIST05898
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | MEEVD |
| Peptide_Length | 5 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2L6J |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90. |
|---|---|
| Release_Year | 2012 |
| PMID | 22179618 |
| DOI | 10.1074/jbc.M111.287458 |