PPIST05899
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | DNEIEVIIVWEKK |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2LAS |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Insights into High Affinity Small Ubiquitin-like Modifier (SUMO) Recognition by SUMO-interacting Motifs (SIMs) Revealed by a Combination of NMR and Peptide Array Analysis. |
|---|---|
| Release_Year | 2012 |
| PMID | 22147707 |
| DOI | 10.1074/jbc.M111.293118 |