PPIST05900
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPELEHHHHHH |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | GKFIPSRPAPKPPSSA |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2LCS |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Distinct Peptide Binding Specificities of Src Homology 3 (SH3) Protein Domains Can Be Determined by Modulation of Local Energetics across the Binding Interface. |
|---|---|
| Release_Year | 2012 |
| PMID | 22277653 |
| DOI | 10.1074/jbc.M111.330753 |