PPIST05918
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | EDHKPGTFPKALTN |
| Peptide_Length | 14 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2LOZ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the phosphotyrosine binding (PTB) domain of human tensin2 protein in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode. |
|---|---|
| Release_Year | 2012 |
| PMID | 22645138 |
| DOI | 10.1074/jbc.M112.360206 |