PPIST06699
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | QRTRQRNETQV |
| Peptide_Length | 11 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2M3M |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural insights into a wildtype domain of the oncoprotein E6 and its interaction with a PDZ domain. |
|---|---|
| Release_Year | 2013 |
| PMID | 23638119 |
| DOI | 10.1371/journal.pone.0062584 |