PPIST06700
Protein Information
| Protein_Chain | A[auth W] |
|---|---|
| Protein_Sequence | GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA |
Peptide Information
| Peptide_Chain | B[auth P] |
|---|---|
| Peptide_Sequence | TAPPPAYATLG |
| Peptide_Length | 11 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2M3O |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure and dynamics of human Nedd4-1 WW3 in complex with the alpha ENaC PY motif. |
|---|---|
| Release_Year | 2013 |
| PMID | 23665454 |
| DOI | 10.1016/j.bbapap.2013.04.031 |