PPIST06710
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GHMQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKE |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | DTEVYESPYADPE |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2MC1 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Differential recognition of syk-binding sites by each of the two phosphotyrosine-binding pockets of the Vav SH2 domain. |
|---|---|
| Release_Year | 2013 |
| PMID | 23955592 |
| DOI | 10.1002/bip.22371 |