PPIST07490
Protein Information
| Protein_Chain | A[auth C] |
|---|---|
| Protein_Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS |
Peptide Information
| Peptide_Chain | B[auth I] |
|---|---|
| Peptide_Sequence | RMSADAMLKALLGSKHK |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2MKP |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Conformation of the critical pH sensitive region of troponin depends upon a single residue in troponin I. |
|---|---|
| Release_Year | 2014 |
| PMID | 24333682 |
| DOI | 10.1016/j.abb.2013.12.003 |