PPIST07491
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | DLDESWDYIFETT |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2MKR |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural and Functional Characterization of a Complex between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 Subunit of TFIIH. |
|---|---|
| Release_Year | 2014 |
| PMID | 24675874 |
| DOI | 10.1371/journal.ppat.1004042 |