PPIST07496
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ARTKQTARKS |
| Peptide_Length | 10 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2MNZ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B. |
|---|---|
| Release_Year | 2014 |
| PMID | 24952722 |
| DOI | 10.1007/s13238-014-0078-4 |