PPIST08247
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XLPAX |
| Peptide_Length | 5 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 2RUI |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure of the Bacillus anthracis Sortase A Enzyme Bound to Its Sorting Signal: A FLEXIBLE AMINO-TERMINAL APPENDAGE MODULATES SUBSTRATE ACCESS. |
|---|---|
| Release_Year | 2015 |
| PMID | 26324714 |
| DOI | 10.1074/jbc.M115.670984 |