PPIST08994
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | NLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | KGNMMSNFFGKAAMNK |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2N1G |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Interaction between the Rev1 C-Terminal Domain and the PolD3 Subunit of Pol zeta Suggests a Mechanism of Polymerase Exchange upon Rev1/Pol zeta-Dependent Translesion Synthesis. |
|---|---|
| Release_Year | 2016 |
| PMID | 26982350 |
| DOI | 10.1021/acs.biochem.5b01282 |