PPIST08999
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GAIAMESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKTR |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | TWRVQRSQNPLKIRLTR |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2N3K |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure of the Brd4 ET domain bound to a C-terminal motif from gamma-retroviral integrases reveals a conserved mechanism of interaction. |
|---|---|
| Release_Year | 2016 |
| PMID | 26858406 |
| DOI | 10.1073/pnas.1516813113 |