PPIST09022
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGKAPRY |
| Peptide_Length | 18 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2RVN |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail |
|---|---|
| Release_Year | 2016 |
| PMID | 26934956 |
| DOI | 10.1038/srep22527 |