PPIST09612
Protein Information
| Protein_Chain | B |
|---|---|
| Protein_Sequence | GSMATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN |
Peptide Information
| Peptide_Chain | A |
|---|---|
| Peptide_Sequence | YVGEDDEEDDDFNENDEDD |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 5GOW |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The Interaction Mode of the Acidic Region of the Cell Cycle Transcription Factor DP1 with TFIIH |
|---|---|
| Release_Year | 2016 |
| PMID | 27825926 |
| DOI | 10.1016/j.jmb.2016.11.001 |